Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCDC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CCDC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04656A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCDC6 |
| Target Synonyms | H4; PTC; TPC; PTC1; TST1; D10S170; CCDC6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, MCF7, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMD | Uniprot ID | Q16204 |
Uniprot Id
Q16204
Target Species
Human
Target Name
CCDC6
Target Full Name
Coiled-coil domain-containing protein 6
Target Involvement
A chromosomal aberration involving CCDC6 is found in papillary thyroid carcinomas (PTCs). Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Note=May be a cytoskeletal protein.
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Cell Biology
Target Synonyms
CCDC 6; CCDC6; CCDC6_HUMAN; Coiled coil domain containing 6; Coiled coil domain containing protein 6; Coiled-coil domain-containing protein 6; D10S170; FLJ32286; H4; Papillary thyroid carcinoma encoded protein; Papillary thyroid carcinoma-encoded protein; Protein H4; PTC; TPC; TST 1; TST1
Target Background
This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
