Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCDC98 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 310-409 of human CCDC98 (Q6UWZ7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against CCDC98 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 310-409 of human CCDC98 (Q6UWZ7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
Western blot analysis of various lysates, using CCDC98 Rabbit mAb at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.
| Cat.No | ADA-13217A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCDC98 |
| Target Synonyms | ABRA1; CCDC98; FAM175A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7, SKOV3 | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 310-409 of human CCDC98 (Q6UWZ7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF | Uniprot ID | Q6UWZ7 |
Uniprot Id
Q6UWZ7
Target Species
Human
Target Name
ABRAXAS1
Target Full Name
BRCA1-A complex subunit Abraxas 1
Target Function
Involved in DNA damage response and double-strand break (DSB) repair. Component of the BRCA1-A complex, acting as a central scaffold protein that assembles the various components of the complex and mediates the recruitment of BRCA1. The BRCA1-A complex specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesion sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at DSBs. This complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX.
Target Involvement
Breast cancer (BC)
Target Subcellular Location
Nucleus.
Target Protein Families
FAM175 family, Abraxas subfamily
Target Synonyms
3830405G04Rik; 5630400M01Rik; ABRA1; ABRAXAS; Abraxas protein; AI506069; AL024423; AV118690; BRCA1-A complex subunit Abraxas; coiled coil domain containing 98; Coiled-coil domain-containing protein 98; F175A_HUMAN; FAM175A; Family with sequence similarity 175 member A; FLJ11520; FLJ12642; FLJ13614; Protein FAM175A
Target Background
This gene encodes a protein that binds to the C-terminal repeats of breast cancer 1 (BRCA1) through a phospho-SXXF motif. The encoded protein recruits ubiquitin interaction motif containing 1 protein to BRCA1 protein and is required for DNA damage resistance, DNA repair, and cell cycle checkpoint control. Pseudogenes of this gene are found on chromosomes 3 and 8. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
