Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-96 of human CCL1 (NP_002972.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-96 of human CCL1 (NP_002972.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from RPMI 8226 cells, using CCL1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-06760A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCL1 |
| Target Synonyms | P500; SISe; TCA3; I-309; SCYA1; CCL1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RPMI 8226 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-96 of human CCL1 (NP_002972.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK | Uniprot ID | P22362 |
Uniprot Id
P22362
Target Species
Human
Target Name
CCL1
Target Full Name
C-C motif chemokine 1
Target Function
Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine beta (chemokine CC) family
Target Research Area
Immunology
Target Synonyms
C-C motif chemokine 1; Ccl1; CCL1_HUMAN; Chemokine CC Motif Ligand 1; inflammatory cytokine I-309; P500; SCYA1; SISe; small inducible cytokine A1; Small-inducible cytokine A1; T lymphocyte secreted protein I-309; T lymphocyte secreted protein I-309; T lymphocyte-secreted protein I-309; TCA3
Target Background
This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine (C-C motif) receptor 8.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
