-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCL17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-94 of human CCL17 (NP_002978.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCL17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-94 of human CCL17 (NP_002978.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09844A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCL17 |
| Target Synonyms | TARC; ABCD-2; SCYA17; A-152E5.3; CCL17 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Recombinant Human CCL17/TARC Protein | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-94 of human CCL17 (NP_002978.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS | Uniprot ID | Q92583 |
Uniprot Id
Q92583
Target Species
Human
Target Name
CCL17
Target Full Name
C-C motif chemokine 17
Target Function
Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine beta (chemokine CC) family
Target Tissue Specificity
Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
Target Synonyms
A-152E5.3; A152E53; ABCD 2; ABCD2; C-C motif chemokine 17; CC chemokine TARC; CCL17; CCL17_HUMAN; Chemokine CC Motif Ligand 17; MGC138271; MGC138273; SCYA17; Small Inducible Cytokine A17; Small Inducible Cytokine A17 Precursor; Small Inducible Cytokine Subfamily A (Cys Cys); Small Inducible Cytokine Subfamily A (Cys Cys) Member 17; Small-inducible cytokine A17; T Cell Directed CC Chemokine; Thymus and activation regulated chemokine ; Thymus and activation-regulated chemokine
Target Background
This gene encodes a member of the SNF1 subfamily of serine/threonine protein kinases. Adaptor-related protein complex 2 (AP-2 complexes) functions during receptor-mediated endocytosis to trigger clathrin assembly, interact with membrane-bound receptors, and recruit encodytic accessory factors. The encoded protein interacts with and phosphorylates a subunit of the AP-2 complex, which promotes binding of AP-2 to sorting signals found in membrane-bound receptors and subsequent receptor endocytosis. Its kinase activity is stimulated by clathrin. This kinase has been shown to play an important role in regulating the clathrin-mediated endocytosis of the rabies virus, facilitating infection. Inhibitors of this kinase are being studied as candidate therapeutics to disrupt the entry of viruses, including SARS-CoV-2, into target cells. It is also involved in positive regulation of Notch pathway signaling in mammals. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Notification