Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCL25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CCL25 (NP_001381563.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CCL25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CCL25 (NP_001381563.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08512A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCL25 |
| Target Synonyms | TECK; Ckb15; SCYA25; TECKvar; Ck beta-15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with CCL25 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CCL25 (NP_001381563.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL | Uniprot ID | O15444 |
Uniprot Id
O15444
Target Species
Human
Target Name
CCL25
Target Full Name
C-C motif chemokine 25
Target Function
Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine beta (chemokine CC) family
Target Tissue Specificity
Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Target Research Area
Immunology
Target Synonyms
A130072A22Rik; C-C motif chemokine 25; CCL 25; CCL25; CCL25_HUMAN; Chemokine (C C motif) ligand 25; Chemokine (CC motif) ligand 25; Chemokine C C motif ligand 25; Chemokine CC motif ligand 25; Chemokine TECK; Ck beta 15; Ckb 15; Ckb15; MGC125074; MGC150327; SCY A25; SCYA 25; SCYA25; Small inducible cytokine A25; Small inducible cytokine A25 isoform 1 precursor; Small inducible cytokine A25 isoform 2 precursor; Small inducible cytokine subfamily A (Cys Cys) member 25; Small inducible cytokine subfamily A Cys Cys member 25; Small inducible cytokine subfamily A; member 25; Small-inducible cytokine A25; TECK; TECKvar; Thymus expressed chemokine; Thymus-expressed chemokine
Target Background
This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
