Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCL4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-92 of human CCL4 (NP_002975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCL4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-92 of human CCL4 (NP_002975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09974A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCL4 |
| Target Synonyms | ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta; CCL4 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-92 of human CCL4 (NP_002975.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN | Uniprot ID | P13236 |
Uniprot Id
P13236
Target Species
Human
Target Name
CCL4
Target Full Name
C-C motif chemokine 4
Target Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine beta (chemokine CC) family
Target Synonyms
MIP 1 beta; Secreted protein G 26; ACT 2; ACT-2; ACT2; AT744.1; AT744.2; C C motif chemokine 4; C C motif chemokine 4 like; C C motif chemokine ligand 4 like 1; C C motif chemokine ligand 4 like 2; CC chemokine ligand 4; CC chemokine ligand 4L1; CC chemokine ligand 4L1d2; CC chemokine ligand 4L2; CCL4; CCL4_HUMAN; ccl4l 1; CCL4L; CCL4L1; Chemokine (C C motif) ligand 4; Chemokine (C C motif) ligand 4 like 1; Chemokine (C C motif) ligand 4 like 1; telomeric; Chemokine (C C motif) ligand 4 like 2; Chemokine CC Motif Ligand 4; G 26; G 26 T lymphocyte secreted protein; G-26 T-lymphocyte-secreted protein; HC21; Immune activation 2; LAG 1; LAG-1; LAG1; Lymphocyte activation gene 1; Lymphocyte activation gene 1 protein; Macrophage inflammatory protein 1 beta; Macrophage inflammatory protein 1-beta; Macrophage inflammatory protein 1b2; MGC104418; MGC126025; MGC126026; MIP-1-beta; MIP-1-beta(1-69); MIP-1-beta(3-69); MIP1 beta; MIP1B; MIP1B1; Monocyte adherence induced protein 5 alpha; PAT 744; Protein H400; SCYA2; SCYA4; SCYA4L; SCYA4L1; SCYA4L2; SCYQ4L2; Secreted protein G 26; Secreted protein G26; SIS gamma; SIS-gamma; Small inducible cytokine A4 (homologous to mouse Mip 1b); Small inducible cytokine A4; small inducible cytokine A4-like; Small-inducible cytokine A4; T cell activation protein 2; T-cell activation protein 2
Target Background
The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
