-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCNB1IP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human CCNB1IP1 (NP_878269.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCNB1IP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human CCNB1IP1 (NP_878269.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11546A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCNB1IP1 |
| Target Synonyms | HEI10; C14orf18; CCNB1IP1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human CCNB1IP1 (NP_878269.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPA | Uniprot ID | Q9NPC3 |
Uniprot Id
Q9NPC3
Target Species
Human
Target Name
CCNB1IP1
Target Full Name
E3 ubiquitin-protein ligase CCNB1IP1
Target Function
Ubiquitin E3 ligase that acts as a limiting factor for crossing-over during meiosis: required during zygonema to limit the colocalization of RNF212 with MutS-gamma-associated recombination sites and thereby establish early differentiation of crossover and non-crossover sites. Later, it is directed by MutL-gamma to stably accumulate at designated crossover sites. Probably promotes the dissociation of RNF212 and MutS-gamma to allow the progression of recombination and the implementation of the final steps of crossing over. Modulates cyclin-B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.; E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
Target Subcellular Location
Nucleus. Chromosome. Note=Associates to the synaptonemal complex.
Target Tissue Specificity
Highly expressed in heart. Detected at intermediate levels in liver and kidney, and at low levels in placenta, brain and lung.
Target Synonyms
C14orf18; CCNB1IP1; Chromosome 14 open reading frame 18; CIP1_HUMAN; Cyclin B1 interacting protein 1; cyclin B1 interacting protein 1; E3 ubiquitin protein ligase; Cyclin-B1-interacting protein 1; E3 ubiquitin-protein ligase CCNB1IP1; Enhancer of invasion 10; Gm288; HEI10; Human enhancer of invasion 10; mei4
Target Background
HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.
Notification