-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 255-354 of human CCR1 (NP_001286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CCR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 255-354 of human CCR1 (NP_001286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11980A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCR1 |
| Target Synonyms | CKR1; CD191; CKR-1; HM145; CMKBR1; MIP1aR; SCYAR1; CCR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RPMI 8226 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 255-354 of human CCR1 (NP_001286.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAG | Uniprot ID | P32246 |
Uniprot Id
P32246
Target Species
Human
Target Name
CCR1
Target Full Name
C-C chemokine receptor type 1
Target Function
Receptor for a C-C type chemokine. Binds to MIP-1-alpha, MIP-1-delta, RANTES, and MCP-3 and, less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Widely expressed in different hematopoietic cells.
Target Research Area
Immunology
Target Synonyms
CCR1; CMKBR1; CMKR1; SCYAR1; C-C chemokine receptor type 1; C-C CKR-1; CC-CKR-1; CCR-1; CCR1; HM145; LD78 receptor; Macrophage inflammatory protein 1-alpha receptor; MIP-1alpha-R; RANTES-R; CD antigen CD191
Target Background
This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p.
Notification