-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCR8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-355 of human CCR8 (P51685) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CCR8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-355 of human CCR8 (P51685) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16052A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCR8 |
| Target Synonyms | CY6; TER1; CCR-8; CKRL1; CDw198; CMKBR8; GPRCY6; CMKBRL2; CC-CKR-8; CCR8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, A549, Mouse lung, Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-355 of human CCR8 (P51685). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL | Uniprot ID | P51685 |
Uniprot Id
P51685
Target Species
Human
Target Name
CCR8
Target Full Name
C-C chemokine receptor type 8
Target Function
Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Research Area
G-protein coupled receptor, Receptor, Transducer
Target Synonyms
CCR8; CKRL1; CMKBR8; CMKBRL2; C-C chemokine receptor type 8; C-C CKR-8; CC-CKR-8; CCR-8; CC chemokine receptor CHEMR1; Chemokine receptor-like 1; CKR-L1; GPR-CY6; GPRCY6; TER1; CD antigen CDw198
Target Background
This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. This gene is located at the chemokine receptor gene cluster region.
Notification