-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCR9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-369 of human CCR9 (NP_112477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCR9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-369 of human CCR9 (NP_112477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11920A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCR9 |
| Target Synonyms | GPR28; CDw199; GPR-9-6; CC-CKR-9; CCR9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-369 of human CCR9 (NP_112477.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL | Uniprot ID | P51686 |
Uniprot Id
P51686
Target Species
Human
Target Name
CCR9
Target Full Name
C-C chemokine receptor type 9
Target Function
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Highly expressed in the thymus and low in lymph nodes and spleen.
Target Research Area
Immunology
Target Synonyms
CCR9; GPR28; C-C chemokine receptor type 9; C-C CKR-9; CC-CKR-9; CCR-9; G-protein coupled receptor 28; GPR-9-6; CD antigen CDw199
Target Background
The protein encoded by this gene is a G protein-coupled receptor with seven transmembrane domains that belongs to the beta chemokine receptor family. Chemokines and their receptors are key regulators of thymocyte migration and maturation in normal and inflammation conditions. This gene is differentially expressed in T lymphocytes of the small intestine and colon, and its interaction with chemokine 25 contributes to intestinal intra-epithelial lymphocyte homing to the small intestine. This suggests a role for this gene in directing immune responses to different segments of the gastrointestinal tract. This gene and its exclusive ligand, chemokine 25, are overexpressed in a variety of malignant tumors and are closely associated with tumor proliferation, apoptosis, invasion, migration and drug resistance. This gene maps to the chemokine receptor gene cluster. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification