-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD117/c-Kit was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 867-976 of human CD117/c-Kit (NP_000213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD117/c-Kit was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 867-976 of human CD117/c-Kit (NP_000213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02447A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD117/c-Kit |
| Target Synonyms | PBT; SCFR; C-Kit; CD117; MASTC; CD117/c-Kit | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 867-976 of human CD117/c-Kit (NP_000213.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV | Uniprot ID | P10721 |
Uniprot Id
P10721
Target Species
Human
Target Name
KIT
Target Full Name
Mast/stem cell growth factor receptor Kit
Target Function
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
Target Involvement
Piebald trait (PBT); Gastrointestinal stromal tumor (GIST); Testicular germ cell tumor (TGCT); Leukemia, acute myelogenous (AML)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cytoplasm.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily
Target Tissue Specificity
[Isoform 3]: In testis, detected in spermatogonia in the basal layer and in interstitial Leydig cells but not in Sertoli cells or spermatocytes inside the seminiferous tubules (at protein level). Expression is maintained in ejaculated spermatozoa (at prot
Target Research Area
Signal Transduction
Target Synonyms
C Kit; c-Kit ; c-Kit Ligand; CD117; Kit; Kit Ligand; KIT oncogene; KIT proto oncogene receptor tyrosine kinase; KIT_HUMAN; Mast cell growth factor receptor; Mast/stem cell growth factor receptor Kit; MGF; p145 c-kit; PBT; Piebald trait protein; Proto oncogene c Kit; Proto oncogene tyrosine protein kinase Kit; Proto-oncogene c-Kit; SCF Receptor; SCFR; soluble KIT variant 1; Steel Factor Receptor; Stem cell factor receptor; tyrosine protein kinase Kit; Tyrosine-protein kinase Kit; v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog; v kit Hardy Zuckerman 4 feline sarcoma viral oncogene like protein; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Target Background
This gene encodes a receptor tyrosine kinase. This gene was initially identified as a homolog of the feline sarcoma viral oncogene v-kit and is often referred to as proto-oncogene c-Kit. The canonical form of this glycosylated transmembrane protein has an N-terminal extracellular region with five immunoglobulin-like domains, a transmembrane region, and an intracellular tyrosine kinase domain at the C-terminus. Upon activation by its cytokine ligand, stem cell factor (SCF), this protein phosphorylates multiple intracellular proteins that play a role in in the proliferation, differentiation, migration and apoptosis of many cell types and thereby plays an important role in hematopoiesis, stem cell maintenance, gametogenesis, melanogenesis, and in mast cell development, migration and function. This protein can be a membrane-bound or soluble protein. Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification