-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD11a/LFA-1A/ITGAL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1071-1170 of human CD11a/LFA-1A/ITGAL (P20701) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD11a/LFA-1A/ITGAL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1071-1170 of human CD11a/LFA-1A/ITGAL (P20701) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13537A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD11a/LFA-1A/ITGAL |
| Target Synonyms | CD11A; LFA-1; LFA1A; CD11a/LFA-1A/ITGAL | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1071-1170 of human CD11a/LFA-1A/ITGAL (P20701). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD | Uniprot ID | P20701 |
Uniprot Id
P20701
Target Species
Human
Target Name
ITGAL
Target Full Name
Integrin alpha-L
Target Function
Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin ITGAL/ITGB2 is a receptor for F11R. Integin ITGAL/ITGB2 is a receptor for the secreted form of ubiquitin-like protein ISG15; the interaction is mediated by ITGAL. Involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Contributes to natural killer cell cytotoxicity. Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils. Required for generation of common lymphoid progenitor cells in bone marrow, indicating a role in lymphopoiesis. Integrin ITGAL/ITGB2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Integrin alpha chain family
Target Tissue Specificity
Leukocytes.
Target Research Area
Immunology
Target Synonyms
Antigen CD11A (p180); lymphocyte function associated antigen 1; alpha polypeptide; CD11 antigen-like family member A; CD11a; CD18; CR3; Integrin alpha-L; Integrin beta 2 ; Integrin gene promoter; ITAL_HUMAN; Itgal; ITGAM; ITGB2; LAD; Leukocyte adhesion glycoprotein LFA-1 alpha chain; Leukocyte function-associated molecule 1 alpha chain; LFA 1 alpha; LFA 1; LFA-1A; LFA1; LFA1A; Lymphocyte function associated antigen 1; MAC1; MFI7; MO1A
Target Background
ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes. LFA-1 plays a central role in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling. Two transcript variants encoding different isoforms have been found for this gene.
Notification