-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD11b was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD11b(NP_000623.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD11b was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD11b(NP_000623.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08451A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD11b |
| Target Synonyms | CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; CD11b/ITGAM | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RAW 264.7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD11b(NP_000623.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPP | Uniprot ID | P11215 |
Uniprot Id
P11215
Target Species
Human
Target Name
ITGAM
Target Full Name
Integrin alpha-M
Target Function
Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens. It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration. In association with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. May regulate phagocytosis-induced apoptosis in extravasated neutrophils. May play a role in mast cell development. Required with TYROBP/DAP12 in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development.
Target Involvement
Systemic lupus erythematosus 6 (SLEB6)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft; Single-pass type I membrane protein.
Target Protein Families
Integrin alpha chain family
Target Tissue Specificity
Predominantly expressed in monocytes and granulocytes. Expressed in neutrophils (at protein level).
Target Research Area
Neuroscience
Target Synonyms
antigen CD11b (p170); Antigen CD11b p170; CD11 antigen like family member B; CD11 antigen-like family member B; CD11b; CD11b/CD18; CD49d; Cell surface glycoprotein MAC-1 subunit alpha; Complement component 3 receptor 3 subunit; Complement Component Receptor 3 Alpha; Complement receptor type 3; Complement receptor type 3, alpha subunit; CR 3 alpha chain (CR3A); CR 3 alpha chain; CR-3 alpha chain; CR3; CR3A; F730045J24Rik; Integrin Alpha M; Integrin alpha M chain; Integrin alpha-M; Integrin beta 2 alpha subunit ; Integrin subunit alpha M; integrin, alpha M (complement component 3 receptor 3 subunit); ITAM_HUMAN; ITGAM; Leukocyte adhesion receptor MO1; Ly-40; MAC 1; Mac-1a; MAC1; Mac1, alpha subunit; MAC1A; Macrophage antigen alpha polypeptide; MGC117044; Mo1; Mo1, alpha subunit; MO1A; Neutrophil adherence receptor alpha M subunit; Neutrophil adherence receptor; SLEB6
Target Background
This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification