Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD127/IL7R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD127/IL7R (P16871) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD127/IL7R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD127/IL7R (P16871) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15806A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD127/IL7R |
| Target Synonyms | ILRA; CD127; IL7RA; CDW127; IMD104; sIL-7R; lnc-IL7R; IL7Ralpha; IL-7Ralpha; IL-7R-alpha; CD127/IL7R | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, Mouse liver, Mouse thymus, PC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD127/IL7R (P16871). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHV | Uniprot ID | P16871 |
Uniprot Id
P16871
Target Species
Human
Target Name
IL7R
Target Full Name
Interleukin-7 receptor subunit alpha
Target Function
Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Target Involvement
Severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID); Multiple sclerosis 3 (MS3)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Secreted.
Target Protein Families
Type I cytokine receptor family, Type 4 subfamily
Target Research Area
Immunology
Target Synonyms
IL7R; Interleukin-7 receptor subunit alpha; IL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA; CDw127; CD antigen CD127
Target Background
The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
