-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD151 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 113-221 of human CD151 (NP_004348.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD151 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 113-221 of human CD151 (NP_004348.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04458A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD151 |
| Target Synonyms | EBS7; GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24; CD151 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat uterus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 113-221 of human CD151 (NP_004348.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR | Uniprot ID | P48509 |
Uniprot Id
P48509
Target Species
Human
Target Name
CD151
Target Full Name
CD151 antigen
Target Function
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.; (Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor.
Target Involvement
Nephropathy with pretibial epidermolysis bullosa and deafness (NPEBD)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Tissue Specificity
Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes.
Target Synonyms
CD151; TSPAN24; CD151 antigen; GP27; Membrane glycoprotein SFA-1; Platelet-endothelial tetraspan antigen 3; PETA-3; Tetraspanin-24; Tspan-24; CD antigen CD151
Target Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.
Notification