-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD155/PVR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD155/PVR (P15151) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD155/PVR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD155/PVR (P15151) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13971A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD155/PVR |
| Target Synonyms | PVS; HVED; CD155; NECL5; TAGE4; Necl-5; CD155/PVR | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, HT-1080, HUVEC | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD155/PVR (P15151). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVL | Uniprot ID | P15151 |
Uniprot Id
P15151
Target Species
Human
Target Name
PVR
Target Full Name
Poliovirus receptor
Target Function
Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytotoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.; (Microbial infection) Acts as a receptor for poliovirus. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.; (Microbial infection) Acts as a receptor for Pseudorabies virus.; (Microbial infection) Is prevented to reach cell surface upon infection by Human cytomegalovirus /HHV-5, presumably to escape immune recognition of infected cell by NK cells.
Target Subcellular Location
[Isoform Alpha]: Cell membrane; Single-pass type I membrane protein.; [Isoform Delta]: Cell membrane; Single-pass type I membrane protein.; [Isoform Beta]: Secreted.; [Isoform Gamma]: Secreted.
Target Protein Families
Nectin family
Target Research Area
Microbiology
Target Synonyms
PVR; PVS; Poliovirus receptor; Nectin-like protein 5; NECL-5; CD antigen CD155
Target Background
The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification