-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD166/ALCAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 484-583 of human CD166/ALCAM (Q13740) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD166/ALCAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 484-583 of human CD166/ALCAM (Q13740) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14212A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD166/ALCAM |
| Target Synonyms | MEMD; CD166; CD166/ALCAM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung, Rat liver, Rat lung, SH-SY5Y, THP-1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 484-583 of human CD166/ALCAM (Q13740). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA | Uniprot ID | Q13740 |
Uniprot Id
Q13740
Target Species
Human
Target Name
ALCAM
Target Full Name
CD166 antigen
Target Function
Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts. Promotes T-cell activation and proliferation via its interactions with CD6. Contributes to the formation and maturation of the immunological synapse via its interactions with CD6. Mediates homotypic interactions with cells that express ALCAM. Required for normal hematopoietic stem cell engraftment in the bone marrow. Mediates attachment of dendritic cells onto endothelial cells via homotypic interaction. Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions. Required for normal organization of the lymph vessel network. Required for normal hematopoietic stem cell engraftment in the bone marrow. Plays a role in hematopoiesis; required for normal numbers of hematopoietic stem cells in bone marrow. Promotes in vitro osteoblast proliferation and differentiation. Promotes neurite extension, axon growth and axon guidance; axons grow preferentially on surfaces that contain ALCAM. Mediates outgrowth and pathfinding for retinal ganglion cell axons.; Inhibits activities of membrane-bound isoforms by competing for the same interaction partners. Inhibits cell attachment via homotypic interactions. Promotes endothelial cell migration. Inhibits endothelial cell tube formation.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.; [Isoform 3]: Secreted.
Target Tissue Specificity
Detected on hematopoietic stem cells derived from umbilical cord blood. Detected on lymph vessel endothelial cells, skin and tonsil. Detected on peripheral blood monocytes. Detected on monocyte-derived dendritic cells (at protein level). Detected at low l
Target Research Area
Cell Adhesion, Immunology
Target Synonyms
Activated leukocyte cell adhesion molecule; ALCAM; ALCAM protein; CD 166; CD166; CD166 antigen; CD166_HUMAN; FLJ3851; FLJ38514; MEMD; MGC71733
Target Background
This gene encodes activated leukocyte cell adhesion molecule (ALCAM), also known as CD166 (cluster of differentiation 166), which is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular domain. This protein binds to T-cell differentiation antigene CD6, and is implicated in the processes of cell adhesion and migration. Multiple alternatively spliced transcript variants encoding different isoforms have been found.
Notification