-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD200R1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 249-348 of human CD200R1 (NP_620161.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD200R1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 249-348 of human CD200R1 (NP_620161.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01544A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD200R1 |
| Target Synonyms | OX2R; MOX2R; CD200R; HCRTR2; CD200R1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NCI-H460, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 249-348 of human CD200R1 (NP_620161.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL | Uniprot ID | Q8TD46 |
Uniprot Id
Q8TD46
Target Species
Human
Target Name
CD200R1
Target Full Name
Cell surface glycoprotein CD200 receptor 1
Target Function
Inhibitory receptor for the CD200/OX2 cell surface glycoprotein. Limits inflammation by inhibiting the expression of proinflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.
Target Protein Families
CD200R family
Target Tissue Specificity
Expressed in granulocytes, monocytes, most T-cells, neutrophils, basophils and a subset of NK, NKT and B-cells (at protein level). Expressed in bone marrow, lymph nodes, spleen, lung, liver, spinal cord, kidney. Expressed in monocyte-derived dendritic and
Target Research Area
Cardiovascular
Target Synonyms
CD 200R; CD200 cell surface glycoprotein receptor; CD200 receptor 1; Cd200r1; Cell surface glycoprotein CD200 receptor 1; Cell surface glycoprotein OX2 receptor 1; Cell surface glycoprotein OX2 receptor; cell surface glycoprotein receptor CD200; CRTR 2; CRTR2; HCRTR2; MO2R1_HUMAN; MOX2 receptor; MOX2R; OX2R
Target Background
This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants.
Notification