-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD209 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-404 of human CD209 (NP_066978.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD209 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-404 of human CD209 (NP_066978.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10182A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD209 |
| Target Synonyms | CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1; hDC-SIGN; CD209 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 265-404 of human CD209 (NP_066978.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA | Uniprot ID | Q9NNX6 |
Uniprot Id
Q9NNX6
Target Species
Human
Target Name
CD209
Target Full Name
CD209 antigen
Target Function
Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response.; On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells.; (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2.; (Microbial infection) Acts as an attachment receptor for Ebolavirus.; (Microbial infection) Acts as an attachment receptor for Cytomegalovirus.; (Microbial infection) Acts as an attachment receptor for HCV.; (Microbial infection) Acts as an attachment receptor for Dengue virus.; (Microbial infection) Acts as an attachment receptor for Measles virus.; (Microbial infection) Acts as an attachment receptor for Herpes simplex virus 1.; (Microbial infection) Acts as an attachment receptor for Influenzavirus A.; (Microbial infection) Acts as an attachment receptor for SARS-CoV.; (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus.; (Microbial infection) Acts as an attachment receptor for Lassa virus. Acts as an attachment receptor for Marburg virusn.; (Microbial infection) Acts as an attachment receptor for Respiratory syncytial virus.; (Microbial infection) Acts as an attachment receptor for Rift valley fever virus and uukuniemi virus.; (Microbial infection) Acts as an attachment receptor for West-nile virus.; (Microbial infection) Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of bacterial pathogen antigens, including Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA. Recognition of M.tuberculosis by dendritic cells occurs partially via this molecule.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type II membrane protein.; [Isoform 2]: Cell membrane; Single-pass type II membrane protein.; [Isoform 3]: Cell membrane; Single-pass type II membrane protein.; [Isoform 4]: Cell membrane; Single-pass type II membrane protein.; [Isoform 5]: Cell membrane; Single-pass type II membrane protein.; [Isoform 6]: Secreted.; [Isoform 7]: Secreted.; [Isoform 8]: Secreted.; [Isoform 9]: Secreted.; [Isoform 10]: Secreted.; [Isoform 11]: Secreted.; [Isoform 12]: Secreted.
Target Tissue Specificity
Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.
Target Synonyms
C type lectin domain family 4 member L; C-type lectin domain family 4 member L; CD 209; CD209; CD209 antigen; CD209 antigen-like protein A; CD209 molecule; CD209_HUMAN; Cd209a; CDSIGN; CIRE; CLEC4L; DC SIGN; DC SIGN1; DC-SIGN; DC-SIGN1; DCSIGN; Dendritic cell specific ICAM 3 grabbing nonintegrin 1; Dendritic cell specific ICAM3 grabbing nonintegrin 1; Dendritic cell-specific ICAM-3-grabbing non-integrin 1; Dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; Dengue fever; protection against; included; Dentritic Cell Specific ICAM3 Grabbing Nonintegrin; HIV GP120 Binding Protein; MGC129965; MGC130443; SIGN-R1; SIGNR5
Target Background
This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including leprosy and tuberculosis mycobacteria, the Ebola, hepatitis C, HIV-1 and Dengue viruses, and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CLEC4M (Gene ID: 10332), also known as L-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression on the surface of dendritic cells. Polymorphisms in the neck region are associated with protection from HIV-1 infection, while single nucleotide polymorphisms in the promoter of this gene are associated with differing resistance and susceptibility to and severity of infectious disease, including rs4804803, which is associated with SARS severity.
Notification