-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD239/BCAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 529-628 of human CD239/BCAM (P50895) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD239/BCAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 529-628 of human CD239/BCAM (P50895) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14264A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD239/BCAM |
| Target Synonyms | AU; LU; CD239; MSK19; CD239/BCAM | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, BxPC-3, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 529-628 of human CD239/BCAM (P50895). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC | Uniprot ID | P50895 |
Uniprot Id
P50895
Target Species
Human
Target Name
BCAM
Target Full Name
Basal cell adhesion molecule
Target Function
Laminin alpha-5 receptor. May mediate intracellular signaling.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.
Target Synonyms
Antigen identified by monoclonal F8 ; AU; Auberger B antigen; B CAM cell surface glycoprotein; B cell adhesion molecule; B-CAM cell surface glycoprotein; Basal cell adhesion molecule (Lu and Au blood groups); Basal cell adhesion molecule (Lutheran blood group); Basal cell adhesion molecule; Basal cell adhesion molecule Lu and Au blood groups; Basal cell adhesion molecule Lutheran blood group; Bcam; BCAM_HUMAN; CD239; CD239 antigen; F8/G253 antigen; Glycoprotein 95kDa; LU; Lutheran; Lutheran antigen; Lutheran blood group (Auberger b antigen included); Lutheran blood group Auberger b antigen included ; Lutheran blood group glycoprotein; MSK19
Target Background
This gene encodes Lutheran blood group glycoprotein, a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five extracellular immunoglobulin domains, a single transmembrane domain, and a short C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Polymorphisms in this gene define some of the antigens in the Lutheran system and also the Auberger system. Inactivating variants of this gene result in the recessive Lutheran null phenotype, Lu(a-b-), of the Lutheran blood group. Two transcript variants encoding different isoforms have been found for this gene.
Notification