Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-80 of human CD24 (NP_037362.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, FC, ELISA.
The antibody against CD24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-80 of human CD24 (NP_037362.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, FC, ELISA.
| Cat.No | ADA-15743A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD24 |
| Target Synonyms | CD24A; CD24 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, SH-SY5Y | Application | ELISA, FC, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-80 of human CD24 (NP_037362.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS | Uniprot ID | P25063 |
Uniprot Id
P25063
Target Species
Human
Target Name
CD24
Target Full Name
Signal transducer CD24
Target Function
May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity.
Target Involvement
Multiple sclerosis (MS)
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
CD24 family
Target Tissue Specificity
B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.
Target Research Area
Immunology
Target Synonyms
CD 24; CD24; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 antigen; CD24 molecule; CD24_HUMAN; CD24A; FLJ22950; FLJ43543; GPI linked surface mucin; Heat stable antigen; HSA; MGC75043; Nectadrin; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen
Target Background
This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
