-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD30 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 496-595 of human CD30 (P28908) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD30 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 496-595 of human CD30 (P28908) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13439A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD30 |
| Target Synonyms | CD30; Ki-1; D1S166E | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 496-595 of human CD30 (P28908). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK | Uniprot ID | P28908 |
Uniprot Id
P28908
Target Species
Human
Target Name
TNFRSF8
Target Full Name
Tumor necrosis factor receptor superfamily member 8
Target Function
Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm.
Target Tissue Specificity
[Isoform 2]: Detected in alveolar macrophages (at protein level).
Target Synonyms
TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Notification