-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD300LF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CD300LF (NP_001276011.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD300LF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CD300LF (NP_001276011.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06007A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD300LF |
| Target Synonyms | CLM1; NKIR; CLM-1; IREM1; LMIR3; CD300f; IREM-1; IgSF13; CD300LF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, K-562, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CD300LF (NP_001276011.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLD | Uniprot ID | Q8TDQ1 |
Uniprot Id
Q8TDQ1
Target Species
Human
Target Name
CD300LF
Target Full Name
CMRF35-like molecule 1
Target Function
Acts as an inhibitory receptor for myeloid cells and mast cells. Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis. Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands. May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling. Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2. Inhibits osteoclast formation. Induces macrophage cell death upon engagement.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
CD300 family
Target Tissue Specificity
Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocy
Target Research Area
Immunology
Target Synonyms
CD300 antigen like family member; CD300 antigen-like family member F; CD300 molecule like family member f; CD300f; CD300LF; CLM; CLM-1; CLM1; CLM1_HUMAN; CMRF35-like molecule 1; IGSF; IgSF13; Immune receptor expressed on myeloid cells 1; immune receptor expressed on myeloid cells; immunoglobin superfamily member; Immunoglobulin superfamily member 13; Immunoglobulin superfamily member; Inhibitory receptor IREM1; IREM; IREM-1; IREM1; Nepmucin; NK inhibitory receptor; NKIR; TREM; triggering receptors expressed on myeloid cells; UNQ3105/PRO10111
Target Background
This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor. Alternative splicing results in multiple transcript variants.
Notification