-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD35 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 901-1095 of human CD35 (NP_000564.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD35 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 901-1095 of human CD35 (NP_000564.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15779A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD35 |
| Target Synonyms | KN; C3BR; C4BR; CD35 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | TF-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 901-1095 of human CD35 (NP_000564.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRC | Uniprot ID | P17927 |
Uniprot Id
P17927
Target Species
Human
Target Name
CR1
Target Full Name
Complement receptor type 1
Target Function
Membrane immune adherence receptor that plays a critical role in the capture and clearance of complement-opsonized pathogens by erythrocytes and monocytes/macrophages. Mediates the binding by these cells of particles and immune complexes that have activated complement to eliminate them from the circulation. Acts also in the inhibition of spontaneous complement activation by impairing the formation and function of the alternative and classical pathway C3/C5 convertases, and by serving as a cofactor for the cleavage by factor I of C3b to iC3b, C3c and C3d,g, and of C4b to C4c and C4d. Plays also a role in immune regulation by contributing, upon ligand binding, to the generation of regulatory T cells from activated helper T cells.; (Microbial infection) Acts as a receptor for Epstein-Barr virus.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Receptors of complement activation (RCA) family
Target Tissue Specificity
Present on erythrocytes, a subset of T cells, mature B cells, follicular dendritic cells, monocytes and granulocytes.
Target Research Area
Others
Target Synonyms
C3 binding protein; C3b/C4b receptor; C3BR; C4BR; CD 35; CD35; CD35 antigen; complement component (3b/4b) receptor 1 (Knops blood group); complement component (3b/4b) receptor 1 including Knops blood group system; Complement component receptor 1; Complement receptor 1; Complement receptor type 1; CR 1; CR1; CR1_HUMAN; KN; Knops blood group antigen
Target Background
This gene is a member of the receptors of complement activation (RCA) family and is located in the 'cluster RCA' region of chromosome 1. The genome is polymorphic at this locus with allele-specific splice variants encoding different isoforms, based on the presence/absence of long homologous repeats (LHRs). The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in this gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus, sarcoidosis and Alzheimer's disease. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria.
Notification