-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD39/ENTPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-442 of human CD39/ENTPD1 (NP_001767.3?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
The antibody against CD39/ENTPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-442 of human CD39/ENTPD1 (NP_001767.3?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
| Cat.No | ADA-15649A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD39/ENTPD1 |
| Target Synonyms | CD39; SPG64; ATPDase; NTPDase-1; CD39/ENTPD1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with CD39/ENTPD1(Human) | Application | ELISA, WB, FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 255-442 of human CD39/ENTPD1 (NP_001767.3?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGK | Uniprot ID | P49961 |
Uniprot Id
P49961
Target Species
Human
Target Name
ENTPD1
Target Full Name
Ectonucleoside triphosphate diphosphohydrolase 1
Target Function
In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation by hydrolyzing platelet-activating ADP to AMP. Hydrolyzes ATP and ADP equally well.
Target Involvement
Spastic paraplegia 64, autosomal recessive (SPG64)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
GDA1/CD39 NTPase family
Target Tissue Specificity
Expressed primarily on activated lymphoid cells. Also expressed in endothelial tissues. Isoform 1 and isoform 3 are present in both placenta and umbilical vein, whereas isoform 2 is present in placenta only.
Target Synonyms
ATPDase; CD 39; CD39; CD39 antigen; DKFZp686D194; DKFZp686I093; Ecto apyrase; Ecto ATP diphosphohydrolase; Ecto-apyrase; Ecto-ATP diphosphohydrolase 1; Ecto-ATPase 1; Ecto-ATPDase 1; Ectonucleoside triphosphate diphosphohydrolase 1; ENTP1_HUMAN; ENTPD 1; ENTPD1; FLJ40921; FLJ40959; Lymphoid cell activation antigen; NTPDase 1; NTPDase1; SPG64
Target Background
The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene.
Notification