-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD3G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human CD3G (NP_000064.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD3G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human CD3G (NP_000064.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04455A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD3G |
| Target Synonyms | T3G; IMD17; CD3GAMMA; CD3-GAMMA; CD3G | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HEL(Negative control), Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human CD3G (NP_000064.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS | Uniprot ID | P09693 |
Uniprot Id
P09693
Target Species
Human
Target Name
CD3G
Target Full Name
T-cell surface glycoprotein CD3 gamma chain
Target Function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.
Target Involvement
Immunodeficiency 17 (IMD17)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Research Area
Immunology
Target Synonyms
CD3G; T3G; T-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD antigen CD3g
Target Background
The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
Notification