-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD46 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD46 (P15529) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD46 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD46 (P15529) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13612A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD46 |
| Target Synonyms | MCP; TLX; AHUS2; MIC10; TRA2.10; CD46 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549, MCF7, SW480 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD46 (P15529). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCP | Uniprot ID | P15529 |
Uniprot Id
P15529
Target Species
Human
Target Name
CD46
Target Full Name
Membrane cofactor protein
Target Function
Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity.; (Microbial infection) A number of viral and bacterial pathogens seem to bind MCP in order to exploit its immune regulation property and directly induce an immunosuppressive phenotype in T-cells.; (Microbial infection) Acts as a receptor for Adenovirus subgroup B2 and Ad3.; (Microbial infection) Acts as a receptor for cultured Measles virus.; (Microbial infection) Acts as a receptor for Herpesvirus 6/HHV-6.; (Microbial infection) May act as a receptor for pathogenic bacteria Neisseria and Streptococcus pyogenes.
Target Involvement
Hemolytic uremic syndrome atypical 2 (AHUS2)
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Note=Inner acrosomal membrane of spermatozoa. Internalized upon binding of Measles virus, Herpesvirus 6 or Neisseria gonorrhoeae, which results in an increased susceptibility of infected cells to complement-mediated injury. In cancer cells or cells infected by Neisseria, shedding leads to a soluble peptide.
Target Tissue Specificity
Expressed by all cells except erythrocytes.
Target Research Area
Immunology
Target Synonyms
CD46; MCP; MIC10; Membrane cofactor protein; TLX; Trophoblast leukocyte common antigen; CD antigen CD46
Target Background
The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. The encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification