Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD58 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-220 of human CD58 (NP_001770.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD58 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-220 of human CD58 (NP_001770.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03716A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD58 |
| Target Synonyms | ag3; LFA3; LFA-3; CD58 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-220 of human CD58 (NP_001770.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIP | Uniprot ID | P19256 |
Uniprot Id
P19256
Target Species
Human
Target Name
CD58
Target Full Name
Lymphocyte function-associated antigen 3
Target Function
Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.
Target Synonyms
CD58; LFA3; Lymphocyte function-associated antigen 3; Ag3; Surface glycoprotein LFA-3; CD antigen CD58
Target Background
This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
