-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD59 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 49-128 of human CD59 (NP_000602.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD59 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 49-128 of human CD59 (NP_000602.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13830A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD59 |
| Target Synonyms | 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20; CD59 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, HT-29, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 49-128 of human CD59 (NP_000602.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP | Uniprot ID | P13987 |
Uniprot Id
P13987
Target Species
Human
Target Name
CD59
Target Full Name
CD59 glycoprotein
Target Function
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
Target Involvement
Hemolytic anemia, CD59-mediated, with or without polyneuropathy (HACD59)
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Note=Soluble form found in a number of tissues.
Target Research Area
Cardiovascular
Target Synonyms
16.3A5; 1F5 ; 1F5 antigen; 20 kDa homologous restriction factor; CD 59; CD_antigen=CD59; CD59; CD59 antigen; CD59 antigen complement regulatory protein ; CD59 antigen p18 20 ; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5; EJ16; EJ30; EL32 and G344); CD59 glycoprotein; CD59 molecule; CD59 molecule complement regulatory protein; CD59_HUMAN; Cd59a; Complement regulatory protein; EJ16; EJ30; EL32; FLJ38134; FLJ92039; G344; HRF 20; HRF-20; HRF20; Human leukocyte antigen MIC11 ; Ly 6 like protein ; Lymphocytic antigen CD59/MEM43 ; MAC inhibitory protein; MAC IP; MAC-inhibitory protein; MAC-IP; MACIF; MACIP; MEM43; MEM43 antigen; Membrane attack complex (MAC) inhibition factor ; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MGC2354; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18 20; Protectin; Surface antigen recognized by monoclonal 16.3A5; T cell activating protein
Target Background
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.
Notification