Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD69 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-199 of human CD69 (NP_001772.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD69 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-199 of human CD69 (NP_001772.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14798A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD69 |
| Target Synonyms | AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26; CD69 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 62-199 of human CD69 (NP_001772.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK | Uniprot ID | Q07108 |
Uniprot Id
Q07108
Target Species
Human
Target Name
CD69
Target Full Name
Early activation antigen CD69
Target Function
Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Tissue Specificity
Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
Target Research Area
Immunology
Target Synonyms
Activation inducer molecule;AIM;BL-AC/P26;C-type lectin domain family 2 member C;EA1;Early T-cell activation antigen p60;GP32/28;Leukocyte surface antigen Leu-23;MLR-3;CD69
Target Background
This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
