Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD80 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD80 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12579A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD80 |
| Target Synonyms | B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1; CD80 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS | Uniprot ID | P33681 |
Uniprot Id
P33681
Target Species
Human
Target Name
CD80
Target Full Name
T-lymphocyte activation antigen CD80
Target Function
Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.; (Microbial infection) Acts as a receptor for adenovirus subgroup B.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed on activated B-cells, macrophages and dendritic cells.
Target Research Area
Immunology
Target Synonyms
CD80; CD28LG; CD28LG1; LAB7; T-lymphocyte activation antigen CD80; Activation B7-1 antigen; BB1; CTLA-4 counter-receptor B7.1; B7; CD antigen CD80
Target Background
The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
