-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD82 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82 (P27701) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD82 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82 (P27701) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15820A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD82 |
| Target Synonyms | R2; 4F9; C33; IA4; ST6; GR15; KAI1; SAR2; TSPAN27; CD82 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Raji | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82 (P27701). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY | Uniprot ID | P27701 |
Uniprot Id
P27701
Target Species
Human
Target Name
CD82
Target Full Name
CD82 antigen
Target Function
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Tissue Specificity
Lymphoid specific.
Target Synonyms
CD82; KAI1; SAR2; ST6; TSPAN27; CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1; Suppressor of tumorigenicity 6 protein; Tetraspanin-27; Tspan-27; CD antigen CD82
Target Background
This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification