Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD83 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD83 (Q01151) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD83 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD83 (Q01151) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16056A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD83 |
| Target Synonyms | BL11; HB15; CD83 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse liver, Raji, U-937 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD83 (Q01151). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSC | Uniprot ID | Q01151 |
Uniprot Id
Q01151
Target Species
Human
Target Name
CD83
Target Full Name
CD83 antigen
Target Function
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
Target Synonyms
CD83; CD83 antigen; hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83
Target Background
The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
