Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD90/Thy1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD90/Thy1 (NP_006279.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD90/Thy1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD90/Thy1 (NP_006279.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded rat brain using CD90/Thy1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-04210A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD90/Thy1 |
| Target Synonyms | CD90; CDw90; CD90/Thy1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD90/Thy1 (NP_006279.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEG | Uniprot ID | P04216 |
Uniprot Id
P04216
Target Species
Human
Target Name
THY1
Target Full Name
Thy-1 membrane glycoprotein
Target Function
May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Synonyms
CD7; CD90; CD90 antigen; CDw90; FLJ33325; MGC128895; T25; Theta antigen; Thy 1; Thy 1 cell surface antigen; Thy 1 membrane glycoprotein; Thy 1 T cell antigen; Thy 1.2; Thy-1 antigen; Thy-1 membrane glycoprotein; Thy1; Thy1 antigen; Thy1 T cell antigen; Thy1.1; Thy1.2; THY1_HUMAN; Thymus cell antigen 1, theta
Target Background
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
