-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDC16 (Q13042) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CDC16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDC16 (Q13042) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14170A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC16 |
| Target Synonyms | APC6; CUT9; ANAPC6; CDC16Hs; CDC16 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDC16 (Q13042). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV | Uniprot ID | Q13042 |
Uniprot Id
Q13042
Target Species
Human
Target Name
CDC16
Target Full Name
Cell division cycle protein 16 homolog
Target Function
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Colocalizes with CDC27 to the centrosome at all stages of the cell cycle and to the mitotic spindle.
Target Protein Families
APC6/CDC16 family
Target Synonyms
ANAPC6; Anaphase promoting complex subunit 6; Anaphase-promoting complex subunit 6; Apc 6; APC6; CDC 16; CDC16 (cell division cycle 16 S. cerevisiae homolog); Cdc16; CDC16 homolog; CDC16 protein; CDC16_HUMAN; CDC16Hs; Cell division cycle 16; Cell division cycle 16 homolog; Cell division cycle protein 16 homolog; CUT9; Cyclosome subunit 6
Target Background
The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified.
Notification