-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CDC20 (NP_001246.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against CDC20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CDC20 (NP_001246.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-12356A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC20 |
| Target Synonyms | CDC20A; OOMD14; p55CDC; OZEMA14; bA276H19.3; CDC20 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CDC20 (NP_001246.2?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ | Uniprot ID | Q12834 |
Uniprot Id
Q12834
Target Species
Human
Target Name
CDC20
Target Full Name
Cell division cycle protein 20 homolog
Target Function
Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
WD repeat CDC20/Fizzy family
Target Research Area
Cell Biology
Target Synonyms
bA276H19.3; Cdc 20; CDC20; CDC20 cell division cycle 20 homolog; CDC20_HUMAN; CDC20A; Cell division cycle 20; Cell division cycle 20 homolog (S. cerevisiae); Cell division cycle 20 homolog; Cell division cycle protein 20 homolog; fizzy; MGC102824; p55CDC
Target Background
CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation.
Notification