Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDC40 (O60508) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CDC40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDC40 (O60508) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14273A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC40 |
| Target Synonyms | EHB3; PCH15; PRP17; PRPF17; CDC40 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HCT116, HepG2, Mouse brain, Mouse lung, Mouse spleen, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDC40 (O60508). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFR | Uniprot ID | O60508 |
Uniprot Id
O60508
Target Species
Human
Target Name
CDC40
Target Full Name
Pre-mRNA-processing factor 17
Target Function
Required for pre-mRNA splicing as component of the activated spliceosome.
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Synonyms
Cdc40; Cell division cycle 40; Cell division cycle 40 homolog; EH binding protein 3; EH-binding protein 3; Ehb3; hPRP17; Pre mRNA processing factor 17; Pre mRNA splicing factor 17; Pre-mRNA-processing factor 17; PRP17; PRP17 homolog; PRP17_HUMAN; PRPF17
Target Background
Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
