Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDCA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human CDCA8 (NP_060571.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDCA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human CDCA8 (NP_060571.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00595A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDCA8 |
| Target Synonyms | BOR; DasraB; MESRGP; BOREALIN; CDCA8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-549, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human CDCA8 (NP_060571.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVDEMIV | Uniprot ID | Q53HL2 |
Uniprot Id
Q53HL2
Target Species
Human
Target Name
CDCA8
Target Full Name
Borealin
Target Function
Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Cytoplasm, cytoskeleton, spindle. Chromosome, centromere.
Target Protein Families
Borealin family
Target Synonyms
BOR; BOREA_HUMAN; Borealin; CDCA8; Cell division cycle associated 8; cell division cycle associated protein 8; Cell division cycle-associated protein 8; Dasra B; Dasra-B; DasraB; FLJ10468; FLJ12042; hDasra B; hDasra-B; MESRGP; OTTHUMP00000004514; pluripotent embryonic stem cell related gene 3 protein; Pluripotent embryonic stem cell-related gene 3 protein
Target Background
This gene encodes a component of the chromosomal passenger complex. This complex is an essential regulator of mitosis and cell division. This protein is cell-cycle regulated and is required for chromatin-induced microtubule stabilization and spindle formation. Alternate splicing results in multiple transcript variants. Pseudgenes of this gene are found on chromosomes 7, 8 and 16.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
