Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDH9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-420 of human CDH9 (NP_057363.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDH9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-420 of human CDH9 (NP_057363.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05491A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDH9 |
| Target Synonyms | CDH9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, K-562, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 340-420 of human CDH9 (NP_057363.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS | Uniprot ID | Q9ULB4 |
Uniprot Id
Q9ULB4
Target Species
Human
Target Name
CDH9
Target Full Name
Cadherin-9
Target Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Research Area
Neuroscience
Target Synonyms
CADH9_HUMAN; Cadherin 9 type 2; Cadherin-9; Cadherin9; CDH 9; CDH9; T1 cadherin
Target Background
This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the protein's homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
