Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDIP1 (NP_001185983.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDIP1 (NP_001185983.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08826A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDIP1 |
| Target Synonyms | I1; CDIP; LITAFL; C16orf5; CDIP1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDIP1 (NP_001185983.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAY | Uniprot ID | Q9H305 |
Uniprot Id
Q9H305
Target Species
Human
Target Name
CDIP1
Target Full Name
Cell death-inducing p53-target protein 1
Target Function
Acts as an important p53/TP53-apoptotic effector. Regulates TNF-alpha-mediated apoptosis in a p53/TP53-dependent manner.
Target Subcellular Location
Late endosome membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
CDIP1/LITAF family
Target Tissue Specificity
Highly expressed in brain. Expressed at lower level in heart, skeletal muscle, kidney, pancreas and liver. Weakly or not expressed in placenta and lung.
Target Synonyms
CDIP1; C16orf5; CDIP; LITAFLCell death-inducing p53-target protein 1; Cell death involved p53-target; Cell death-inducing protein; LITAF-like protein; Lipopolysaccharide-induced tumor necrosis factor-alpha-like protein; Transmembrane protein I1
Target Background
Predicted to enable metal ion binding activity. Acts upstream of or within intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and tumor necrosis factor-mediated signaling pathway. Located in cytoplasmic side of late endosome membrane; cytoplasmic side of lysosomal membrane; and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
