-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-516 of human CDK12 (NP_057591.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against CDK12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-516 of human CDK12 (NP_057591.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-14458A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK12 |
| Target Synonyms | CRK7; CRKR; CRKRS; CDK12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 420-516 of human CDK12 (NP_057591.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPK | Uniprot ID | Q9NYV4 |
Uniprot Id
Q9NYV4
Target Species
Human
Target Name
CDK12
Target Full Name
Cyclin-dependent kinase 12
Target Function
Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors.
Target Involvement
Chromosomal aberrations involving CDK12 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with ERBB2, leading to CDK12-ERBB2 fusion leading to trunctated CDK12 protein not in-frame with ERBB2.
Target Subcellular Location
Nucleus. Nucleus speckle. Note=Colocalized with nuclear speckles throughout interphase.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
arginine/serine-rich; Cdc2 related kinase arginine/serine rich; CDC2 related protein kinase 7; Cdc2-related kinase; CDC2-related protein kinase 7; Cdk12; CDK12_HUMAN; Cell division cycle 2 related protein kinase 7; Cell division cycle 2-related protein kinase 7; Cell division protein kinase 12; CRK7; CRKR; CrkRS; Cyclin-dependent kinase 12; EC 2.7.11.22; hCDK12; kiaa0904; Pksc
Target Background
Enables RNA polymerase II CTD heptapeptide repeat kinase activity and cyclin binding activity. Involved in phosphorylation of RNA polymerase II C-terminal domain; protein autophosphorylation; and regulation of MAP kinase activity. Located in nuclear speck. Part of cyclin K-CDK12 complex.
Notification