-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 312-451 of human CDK14 (NP_036527.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDK14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 312-451 of human CDK14 (NP_036527.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00608A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK14 |
| Target Synonyms | PFTK1; PFTAIRE1; CDK14 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 312-451 of human CDK14 (NP_036527.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH | Uniprot ID | O94921 |
Uniprot Id
O94921
Target Species
Human
Target Name
CDK14
Target Full Name
Cyclin-dependent kinase 14
Target Function
Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. May also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cytoplasm. Nucleus. Note=Recruited to the cell membrane by CCNY.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Tissue Specificity
Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected.
Target Synonyms
cdk14; CDK14_HUMAN; Cell division protein kinase 14; Cyclin-dependent kinase 14; hPFTAIRE1; KIAA0834; mKIAA0834; PFTAIRE protein kinase 1; PFTAIRE1; PFTK1; Serine/threonine protein kinase PFTAIRE 1; Serine/threonine-protein kinase PFTAIRE-1
Notification