Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 271-400 of human CDK15 (NP_001248365.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDK15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 271-400 of human CDK15 (NP_001248365.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09589A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK15 |
| Target Synonyms | PFTK2; ALS2CR7; PFTAIRE2; CDK15 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 271-400 of human CDK15 (NP_001248365.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLGATEYSSELDIWGAGCIFIEMFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDE | Uniprot ID | Q96Q40 |
Uniprot Id
Q96Q40
Target Species
Human
Target Name
CDK15
Target Full Name
Cyclin-dependent kinase 15
Target Function
Serine/threonine-protein kinase that acts like an antiapoptotic protein that counters TRAIL/TNFSF10-induced apoptosis by inducing phosphorylation of BIRC5 at 'Thr-34'.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Research Area
Signal Transduction
Target Synonyms
CDK15; ALS2CR7; PFTK2Cyclin-dependent kinase 15; EC 2.7.11.22; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein; Cell division protein kinase 15; Serine/threonine-protein kinase ALS2CR7; Serine/threonine-protein kinase PFTAIRE-2
Target Background
Enables protein serine/threonine kinase activity. Predicted to be involved in protein phosphorylation and regulation of transcription involved in G1/S transition of mitotic cell cycle. Predicted to be active in cytosol and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
