Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK19 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CDK19 (XP_005266928.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CDK19 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CDK19 (XP_005266928.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10002A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK19 |
| Target Synonyms | CDK11; DEE87; CDC2L6; EIEE87; bA346C16.3; CDK19 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CDK19 (XP_005266928.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS | Uniprot ID | Q9BWU1 |
Uniprot Id
Q9BWU1
Target Species
Human
Target Name
CDK19
Target Full Name
Cyclin-dependent kinase 19
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Nucleus.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Synonyms
bA346C16.3; CDC2 related protein kinase 6; CDC2-related protein kinase 6; CDC2L6; CDK11; Cdk19; CDK19_HUMAN; CDK8 like cyclin dependent kinase; Cell division cycle 2 like 6 (CDK8 like); Cell division cycle 2 like protein kinase 6; Cell division cycle 2-like protein kinase 6; Cell division protein kinase 19; Cyclin dependent kinase (CDC2 like) 11; Cyclin dependent kinase 11; Cyclin dependent kinase 19 variant 2; Cyclin-dependent kinase 11; Cyclin-dependent kinase 19; Death preventing kinase; Death-preventing kinase; KIAA1028
Target Background
This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
