-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK2AP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDK2AP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07810A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK2AP1 |
| Target Synonyms | DOC1; ST19; DORC1; doc-1; p12DOC-1; CDK2AP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, 293T, U-87 MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS | Uniprot ID | O14519 |
Uniprot Id
O14519
Target Species
Human
Target Name
CDK2AP1
Target Full Name
Cyclin-dependent kinase 2-associated protein 1
Target Function
specific inhibitor of the cell-cycle kinase CDK2.
Target Protein Families
CDK2AP family
Target Research Area
Cell Cycle
Target Synonyms
CDK2 A1; CDK2 associated protein 1; CDK2-associated protein 1; CDK2AP1; CDKA1; CDKA1_HUMAN; Cyclin dependent kinase 2 associated protein 1; Cyclin-dependent kinase 2-associated protein 1; Deleted in oral cancer 1; DOC 1; DOC 1 related protein; DOC 1R; DOC-1; DOC1; DOC1R; DORC1; p12DOC 1; Putative oral cancer suppressor; ST19
Target Background
The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification