-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CDK4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-17270A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK4 |
| Target Synonyms | CMM3; PSK-J3; K4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Monkey | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, COS-7, Mouse lung, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE | Uniprot ID | P11802 |
Uniprot Id
P11802
Target Species
Human
Target Name
CDK4
Target Full Name
Cyclin-dependent kinase 4
Target Function
Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
Target Involvement
Melanoma, cutaneous malignant 3 (CMM3)
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus membrane.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Research Area
Cancer, Cell Cycle
Target Synonyms
Cdk 4; cdk4; CDK4 protein; CDK4_HUMAN; Cell division kinase 4; Cell division protein kinase 4; CMM 3; CMM3; Crk3; Cyclin dependent kinase 4; Cyclin-dependent kinase 4; Melanoma cutaneous malignant 3; MGC14458; p34 cdk4; PSK J3; PSK-J3
Target Background
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.
Notification