-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK5RAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1744-1893 of human CDK5RAP2 (NP_060719.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDK5RAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1744-1893 of human CDK5RAP2 (NP_060719.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05028A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK5RAP2 |
| Target Synonyms | C48; MCPH3; Cep215; CDK5RAP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1744-1893 of human CDK5RAP2 (NP_060719.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS | Uniprot ID | Q96SN8 |
Uniprot Id
Q96SN8
Target Species
Human
Target Name
CDK5RAP2
Target Full Name
CDK5 regulatory subunit-associated protein 2
Target Function
Potential regulator of CDK5 activity via its interaction with CDK5R1. Negative regulator of centriole disengagement (licensing) which maintains centriole engagement and cohesion. Involved in regulation of mitotic spindle orientation. Plays a role in the spindle checkpoint activation by acting as a transcriptional regulator of both BUBR1 and MAD2 promoter. Together with EB1/MAPRE1, may promote microtubule polymerization, bundle formation, growth and dynamics at the plus ends. Regulates centrosomal maturation by recruitment of the gamma-tubulin ring complex (gamma-TuRC) onto centrosomes. In complex with PDE4DIP isoform 13/MMG8/SMYLE, MAPRE1 and AKAP9, contributes to microtubules nucleation and extension from the centrosome to the cell periphery. Required for the recruitment of AKAP9 to centrosomes. Plays a role in neurogenesis.
Target Involvement
Microcephaly 3, primary, autosomal recessive (MCPH3)
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Golgi apparatus. Cytoplasm. Cytoplasm, cytoskeleton.
Target Tissue Specificity
Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
C48; CDK5 activator-binding protein C48; CDK5 regulatory subunit associated protein 2; CDK5 regulatory subunit-associated protein 2; CDK5RAP2; centrosomal protein 215 kDa; Centrosome-associated protein 215; CEP215; CK5P2_HUMAN; MCPH3
Target Background
This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants.
Notification