-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDKN1C/p57 Kip2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human CDKN1C/p57 Kip2 (NP_000067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDKN1C/p57 Kip2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human CDKN1C/p57 Kip2 (NP_000067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11315A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDKN1C/p57 Kip2 |
| Target Synonyms | BWS; WBS; p57; BWCR; KIP2; p57Kip2; CDKN1C/p57 Kip2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse lung, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human CDKN1C/p57 Kip2 (NP_000067.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPR | Uniprot ID | P49918 |
Uniprot Id
P49918
Target Species
Human
Target Name
CDKN1C
Target Full Name
Cyclin-dependent kinase inhibitor 1C
Target Function
Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.
Target Involvement
Beckwith-Wiedemann syndrome (BWS); Intrauterine growth retardation, metaphyseal dysplasia, adrenal hypoplasia congenita, and genital anomalies (IMAGE)
Target Subcellular Location
Nucleus.
Target Protein Families
CDI family
Target Tissue Specificity
Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. Expressed in the eye. High levels are seen in the placenta while low levels are seen in the liver.
Target Synonyms
Beckwith Wiedemann syndrome; BWCR; BWS; CDKI; CDKN 1C; CDKN1C; CDN1C_HUMAN; Cyclin dependent kinase inhibitor 1C; Cyclin dependent kinase inhibitor p57; Cyclin-dependent kinase inhibitor 1C; Cyclin-dependent kinase inhibitor p57; KIP 2; KIP2; p57; p57 Kip 2; p57KIP2; WBS
Target Background
This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.
Notification