-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDKN2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-138 of human CDKN2B (NP_004927.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDKN2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-138 of human CDKN2B (NP_004927.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11186A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDKN2B |
| Target Synonyms | P15; MTS2; TP15; CDK4I; INK4B; p15INK4b; CDKN2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse small intestine, Rat lung, THP-1(negative) | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-138 of human CDKN2B (NP_004927.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD | Uniprot ID | P42772 |
Uniprot Id
P42772
Target Species
Human
Target Name
CDKN2B
Target Full Name
Cyclin-dependent kinase 4 inhibitor B
Target Function
Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
Target Subcellular Location
Cytoplasm. Note=Also found in the nucleus.
Target Protein Families
CDKN2 cyclin-dependent kinase inhibitor family
Target Tissue Specificity
Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines.
Target Research Area
Cancer
Target Synonyms
CDK inhibitory protein; CDK4B Inhibitor; Cdkn2b; CDN2B_HUMAN; Cyclin dependent kinase 4 inhibitor B; Cyclin Dependent Kinase Inhibitor 2B; Cyclin dependent kinase inhibitor 2B p15 inhibits CDK4; Cyclin dependent kinases 4 and 6 binding protein; Cyclin-dependent kinase 4 inhibitor B; INK4B; MTS 2; MTS-2; MTS2; Multiple tumor suppressor 2; Multiple Tumor Supressor 2; OTTHUMP00000021154; OTTHUMP00000021155; p14 CDK inhibitor; p14 INK4b; p14-INK4b; P15; p15 CDK inhibitor; p15 inhibits CDK4; p15 INK4b; p15-INK4b; p15INK4B; TP 15; TP15
Target Background
This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported.
Notification