-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDKN2C/p18-INK4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human CDKN2C/p18-INK4C (P42773) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDKN2C/p18-INK4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human CDKN2C/p18-INK4C (P42773) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06395A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDKN2C/p18-INK4C |
| Target Synonyms | p18; INK4C; p18-INK4C; CDKN2C/p18-INK4C | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse testis, Raji, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human CDKN2C/p18-INK4C (P42773). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ | Uniprot ID | P42773 |
Uniprot Id
P42773
Target Species
Human
Target Name
CDKN2C
Target Full Name
Cyclin-dependent kinase 4 inhibitor C
Target Function
Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.
Target Protein Families
CDKN2 cyclin-dependent kinase inhibitor family
Target Tissue Specificity
Highest levels found in skeletal muscle. Also found in pancreas and heart.
Target Synonyms
CDK6 inhibitor p18; CDKN 2C; CDKN 6; Cdkn2c; CDKN6; CDN2C_HUMAN; Cyclin dependent inhibitor; Cyclin dependent kinase 4 inhibitor C; Cyclin dependent kinase 6 inhibitor; Cyclin dependent kinase 6 inhibitor p18; Cyclin dependent kinase inhibitor 2C (p18 inhibits CDK4); Cyclin dependent kinase inhibitor 2C; Cyclin-dependent kinase 4 inhibitor C; Cyclin-dependent kinase 6 inhibitor; INK4C; OTTHUMP00000046546; p18; p18 inhibits CDK4; p18 INK4c; p18 INK6; p18-INK4c; p18-INK6
Target Background
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.
Notification